2024 Halothece sp. pcc 7418

Halothece sp. pcc 7418

Author: cnrk

August undefined, 2024

WebJul 1, 2024 · The cyanobacterium Halothece sp. PCC 7418 (hereafter referred to as Halothece) exhibits remarkable halotolerance and was used to examine stress … WebIn a previous study, the P-requirements of Halothece sp. PCC 7418 increased in N-limited conditions (i.e., when N 2 -fixation was stimulated), consequently activating their P-acquisition ...

Diversity Free Full-Text Cell Plasticity of Marine Mediterranean ...

WebHalothece sp. PCC 7418: Annotation: yes: Taxonomy: TAX: 65093: Lineage: Bacteria; Cyanobacteriota; Cyanophyceae; Oscillatoriophycideae; Chroococcales; … WebSep 15, 2024 · The cyanobacterium Halothece sp. PCC 7418 (hereafter referred to as Halothece) exhibits remarkable halotolerance and was used to examine stress … is chicken broth ok for cats

6OWF: Structure of a synthetic beta-carboxysome shell, …

WebHalothece 7418, formerly identified as Aphanothece halophytica [ 5 ], is a halotolerant cyanobacterium, which was originally isolated from the Dead Sea, that can grow under … WebDownload alignment. Pentapeptide repeats (8 copies) These repeats are found in many cyanobacterial proteins. The repeats were first identified in hglK. The function of these repeats is unknown. The structure of this repeat has been predicted to be a beta-helix. The repeat can be approximately described as A (D/N)LXX, where X can be any amino acid. WebSep 15, 2024 · A class I fructose-1,6-bisphosphate aldolase is associated with salt stress tolerance in a halotolerant cyanobacterium Halothece sp. PCC 7418 Fructose-1,6 … ruthann9 gmail.com

Halothece sp. pcc 7418

Identification of bidirectional hydrogenase genes and their co ...

WebHalothece sp. PCC 7418: PCC7418_1583: Help: Entry: PCC7418_1583 CDS T02379 : Name (GenBank) sodium/proton antiporter, CPA1 family. KO: K03316 : monovalent cation:H+ antiporter, CPA1 family: Organism: hao Halothece sp. PCC 7418. Brite: KEGG Orthology (KO) [BR:hao00001] 09190 Not Included in Pathway or Brite Web>SOLUE06479 Q01S10 OMAGroup:967577 [Solibacter usitatus (strain Ellin6076)] MDNSVFYLIYSSSAIRLLSDEELQAIHTRASEGNQRRGITGFLLYRGGNFMQLLEGEETTVRGLFEKIKSDPRHKDVYVL ...

Did you know?

WebHalothece sp. (strain PCC 7418) (Synechococcus sp. (strain PCC 7418)) (NCBI taxonomy ID 65093) Length: 700 amino acids Reference Proteome: Please note: when we start each new Pfam data release, we take a copy of the UniProt sequence database. This snapshot of UniProt forms the basis of the overview that you see here. WebSelect to display Genome Domains Proteins; No Yes : ALL: 162870: 162870: No Yes : Homo sapiens 76_38: Human: 111: 106: No Yes : Pan troglodytes 76_2.1.4: Chimpanzee ...

WebProject name: Halothece sp. PCC 7418 ( Project ID: 1077309 ) Product: Microbial Annotated Finished, Isolate Proposal Name: PCC-GEBA (Proposal ID: 894) Project PI: … WebAug 4, 2024 · The cyanobacterium Halothece sp. PCC 7418 (hereafter referred to as Halothece) exhibits remarkable halotolerance and was used to examine stress-responsive regulatory mechanisms. The effects of ...

WebGlobal transcriptome analyses and regulatory mechanisms in Halothece sp. PCC 7418 exposed to abiotic stresses. 15 September 2024. ... In this study, the gene expression changes of Synechocystis sp. PCC 6803 in response to acid stress were examined using DNA microarrays (CyanoCHIP). We compared gene expression profiles of the cells … WebDefinition of haleth in the Definitions.net dictionary. Meaning of haleth. What does haleth mean? Information and translations of haleth in the most comprehensive dictionary …

WebHalothece sp. (strain PCC 7418) (Synechococcus sp. (strain PCC 7418)) (NCBI taxonomy ID 65093) Length: 401 amino acids Reference Proteome: Please note: when we start each new Pfam data release, we take a copy of the UniProt sequence database. This snapshot of UniProt forms the basis of the overview that you see here.

WebThe Halteh family name was found in Scotland in 1871. In 1871 there were 2 Halteh families living in Stirlingshire. This was 100% of all the recorded Halteh's in Scotland. … ruthann\u0027s bellaire miWebTaxonomy information for Halothece sp. PCC 7418. Find diseases associated with this biological target and compounds tested against it in bioassay experiments. This … ruthann\u0027s family meals sioux falls sdWebAug 12, 2024 · Halothece sp. PCC7418 (originally identified as Aphanothece halophytica 1; hereafter referred to as Halothece), isolated from the Dead Sea, is classified as a … ruthann\\u0027s bellaire miWeb- Thesis topic: Functional Characterization of Natural Sunscreen Compound Mycosporine-2-glycine from Extremophilic Cyanobacterium Halothece sp. PCC 7418 in Macrophage Cell Line and Fresh Water Cyanobacterium - Research collaborated with Meijo University (Nagoya, Japan) ruthann\\u0027s family meals sioux falls sdWebHalothece sp. (strain PCC 7418) (Synechococcus sp. (strain PCC 7418)) (NCBI taxonomy ID 65093) Length: 163 amino acids Reference Proteome: Please note: when we start each new Pfam data release, we take a copy of the UniProt sequence database. This snapshot of UniProt forms the basis of the overview that you see here. is chicken broth ok for dogs to eatWebJun 29, 2024 · Global transcriptome analyses and regulatory mechanisms in Halothece sp. PCC 7418 exposed to abiotic stresses. 15 September 2024 ... Fathalli A, Bellakhal M, Chomérat N, Masseret E, Laabir M, Turki S, Aleya L (2015) Alexandrium pacificum Litaker sp. nov (Group IV): resting cyst distribution and toxin profile of vegetative cells in Bizerte ... is chicken broth okay for catsWebStructure of Halothece sp. PCC 7418 CcmK4: Resolution: Method: X-RAY DIFFRACTION: Length: 117 Amino Acids: Molecular Weight: 12,602 Da: Organism: Halothece sp. … is chicken broth powder vegetarian